SCOPe 2.06: Domain d4p16a2: 4p16 A:62-319

Lineage for d4p16a2 (4p16 A:62-319)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, catalytic domain [310795] (3 species)

7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (5 PDB entries)

8. Domain d4p16a2: 4p16 A:62-319 [307968]
   Other proteins in same PDB: d4p16a1
   complexed with zn

Details for d4p16a2

PDB Entry: 4p16, 2.5 Å

PDB Description: crystal structure of the papain-like protease of middle-east respiratory syndrome coronavirus

PDB Compounds: (A:) ORF1a

SCOPe Domain Sequences for d4p16a2:

Sequence, based on SEQRES records:

>d4p16a2 d.3.1.23 (A:62-319) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyss

Sequence, based on observed residues (ATOM records):

>d4p16a2 d.3.1.23 (A:62-319) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgvghyvharlkgglilkfdsgtvsktsdwkc
kvtdvlfpgqkyss

Timeline for d4p16a2:

• d4p16a2 is new in SCOPe 2.06-stable
  
• d4p16a2 appears in SCOPe 2.07
  
• d4p16a2 appears in the current release, SCOPe 2.08