SCOPe 2.06: Domain d4ovza2: 4ovz A:63-313

Lineage for d4ovza2 (4ovz A:63-313)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (5 species)
   not a true protein

7. Species Sars coronavirus [TaxId:228330] [311412] (2 PDB entries)

8. Domain d4ovza2: 4ovz A:63-313 [307962]
   Other proteins in same PDB: d4ovza1
   automated match to d2fe8a2
   complexed with dms, na, p85, zn

Details for d4ovza2

PDB Entry: 4ovz, 2.5 Å

PDB Description: x-ray structural and biological evaluation of a series of potent and highly selective inhibitors of human coronavirus papain-like proteases

PDB Compounds: (A:) papain-like proteinase

SCOPe Domain Sequences for d4ovza2:

Sequence; same for both SEQRES and ATOM records:

>d4ovza2 d.3.1.23 (A:63-313) automated matches {Sars coronavirus [TaxId: 228330]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytt

Timeline for d4ovza2:

• d4ovza2 is new in SCOPe 2.06-stable
  
• d4ovza2 appears in SCOPe 2.07
  
• d4ovza2 appears in the current release, SCOPe 2.08