Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
Protein automated matches [310868] (5 species) not a true protein |
Species Sars coronavirus [TaxId:228330] [311412] (2 PDB entries) |
Domain d4ovza2: 4ovz A:63-313 [307962] Other proteins in same PDB: d4ovza1 automated match to d2fe8a2 complexed with dms, na, p85, zn |
PDB Entry: 4ovz (more details), 2.5 Å
SCOPe Domain Sequences for d4ovza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ovza2 d.3.1.23 (A:63-313) automated matches {Sars coronavirus [TaxId: 228330]} dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt dvfyketsytt
Timeline for d4ovza2: