Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Sinorhizobium fredii [TaxId:380] [311408] (2 PDB entries) |
Domain d4omzf_: 4omz F: [307922] automated match to d3jthb_ complexed with po4 |
PDB Entry: 4omz (more details), 2.64 Å
SCOPe Domain Sequences for d4omzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omzf_ a.4.5.0 (F:) automated matches {Sinorhizobium fredii [TaxId: 380]} qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk lraqnlvstrrdaqtiyyssssdsvmkilgalseiyga
Timeline for d4omzf_: