Lineage for d4omza_ (4omz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695035Species Sinorhizobium fredii [TaxId:380] [311408] (2 PDB entries)
  8. 2695040Domain d4omza_: 4omz A: [307917]
    automated match to d3jthb_
    complexed with po4

Details for d4omza_

PDB Entry: 4omz (more details), 2.64 Å

PDB Description: Crystal Structure of NolR from Sinorhizobium fredii
PDB Compounds: (A:) NolR

SCOPe Domain Sequences for d4omza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omza_ a.4.5.0 (A:) automated matches {Sinorhizobium fredii [TaxId: 380]}
qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk
lraqnlvstrrdaqtiyyssssdsvmkilgalseiyga

SCOPe Domain Coordinates for d4omza_:

Click to download the PDB-style file with coordinates for d4omza_.
(The format of our PDB-style files is described here.)

Timeline for d4omza_: