SCOP 1.63: Domain d1derd2: 1der D:191-366

Lineage for d1derd2 (1der D:191-366)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in all proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)

6. Protein GroEL, A domain [52031] (3 species)

7. Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)

8. Domain d1derd2: 1der D:191-366 [30791]
   Other proteins in same PDB: d1dera1, d1dera3, d1derb1, d1derb3, d1derc1, d1derc3, d1derd1, d1derd3, d1dere1, d1dere3, d1derf1, d1derf3, d1derg1, d1derg3, d1derh1, d1derh3, d1deri1, d1deri3, d1derj1, d1derj3, d1derk1, d1derk3, d1derl1, d1derl3, d1derm1, d1derm3, d1dern1, d1dern3

Details for d1derd2

PDB Entry: 1der, 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of the bacterial chaperonin groel complexed with atp-gamma-s

SCOP Domain Sequences for d1derd2:

Sequence; same for both SEQRES and ATOM records:

>d1derd2 c.8.5.1 (D:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

Timeline for d1derd2:

• d1derd2 first appeared (with stable ids) in SCOP 1.55
  
• d1derd2 appears in SCOP 1.61
  
• d1derd2 does not appear in SCOP 1.65