Lineage for d4oa9a_ (4oa9 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2223673Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (25 PDB entries)
  8. 2223715Domain d4oa9a_: 4oa9 A: [307854]
    automated match to d4ztla_
    complexed with anp, mn

Details for d4oa9a_

PDB Entry: 4oa9 (more details), 2.7 Å

PDB Description: crystal structure of the bri1 kinase domain (865-1160) in complex with amppnp and mn from arabidopsis thaliana
PDB Compounds: (A:) Protein BRASSINOSTEROID INSENSITIVE 1

SCOPe Domain Sequences for d4oa9a_:

Sequence, based on SEQRES records: (download)

>d4oa9a_ d.144.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kplrklafadllqatngfhndsligsggfgdvykailkdgsavaikklihvsgqgdrefm
aemetigkikhrnlvpllgyckvgderllvyefmkygsledvlhdpkkagvklnwstrrk
iaigsarglaflhhncsphiihrdmkssnvlldenlearvsdfgmarlmsamdthlsvst
lagtpgyvppeyyqsfrcstkgdvysygvvllelltgkrptdspdfgdnnlvgwvkqhak
lrisdvfdpelmkedpaleiellqhlkvavaclddrawrrptmvqvmamfkeiqa

Sequence, based on observed residues (ATOM records): (download)

>d4oa9a_ d.144.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kplrklafadllqatngfhndsligsggfgdvykailkdgsavaikklihvsgqgdrefm
aemetigkikhrnlvpllgyckvgderllvyefmkygsledvlhdpkkagvklnwstrrk
iaigsarglaflhhncsphiihrdmkssnvlldenlearvsdfgmarlmsamdthlsvst
lagtpgyvppeyyqsfrcstkgdvysygvvllelltgkrptdskqhaklrisdvfdpelm
kedpaleiellqhlkvavaclddrawrrptmvqvmamfkeiqa

SCOPe Domain Coordinates for d4oa9a_:

Click to download the PDB-style file with coordinates for d4oa9a_.
(The format of our PDB-style files is described here.)

Timeline for d4oa9a_:

  • d4oa9a_ is new in SCOPe 2.06-stable
  • d4oa9a_ became obsolete in SCOPe 2.07