Lineage for d1oele2 (1oel E:191-366)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21364Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 21365Family c.8.5.1: GroEL [52030] (1 protein)
  6. 21366Protein GroEL [52031] (2 species)
  7. 21367Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 21382Domain d1oele2: 1oel E:191-366 [30785]
    Other proteins in same PDB: d1oela1, d1oela3, d1oelb1, d1oelb3, d1oelc4, d1oelc5, d1oeld1, d1oeld3, d1oele1, d1oele3, d1oelf1, d1oelf3, d1oelg1, d1oelg3

Details for d1oele2

PDB Entry: 1oel (more details), 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution

SCOP Domain Sequences for d1oele2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oele2 c.8.5.1 (E:191-366) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1oele2:

Click to download the PDB-style file with coordinates for d1oele2.
(The format of our PDB-style files is described here.)

Timeline for d1oele2: