Lineage for d1oelb2 (1oel B:191-366)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310107Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 310214Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 310215Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 310216Protein GroEL, A domain [52031] (3 species)
  7. 310217Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)
  8. 310244Domain d1oelb2: 1oel B:191-366 [30782]
    Other proteins in same PDB: d1oela1, d1oela3, d1oelb1, d1oelb3, d1oelc4, d1oelc5, d1oeld1, d1oeld3, d1oele1, d1oele3, d1oelf1, d1oelf3, d1oelg1, d1oelg3

Details for d1oelb2

PDB Entry: 1oel (more details), 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution

SCOP Domain Sequences for d1oelb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oelb2 c.8.5.1 (B:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1oelb2:

Click to download the PDB-style file with coordinates for d1oelb2.
(The format of our PDB-style files is described here.)

Timeline for d1oelb2: