SCOPe 2.04: Domain d1jona_: 1jon A:

Lineage for d1jona_ (1jon A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)

8. Domain d1jona_: 1jon A: [30780]
   separately expressed fragment

Details for d1jona_

PDB Entry: 1jon, 2.5 Å

PDB Description: groel (hsp60 class) fragment comprising residues 191-345

PDB Compounds: (A:) groEL, hsp60 class

SCOPe Domain Sequences for d1jona_:

Sequence, based on SEQRES records:

>d1jona_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

Sequence, based on observed residues (ATOM records):

>d1jona_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvimelekatle
dlgqakrvvinkdtttiidgv

Timeline for d1jona_:

• d1jona_ first appeared (with stable ids) in SCOP 1.55, called d1jon__
  
• d1jona_ appears in SCOPe 2.03
  
• d1jona_ appears in SCOPe 2.05
  
• d1jona_ appears in the current release, SCOPe 2.08