Lineage for d1jon__ (1jon -)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176798Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 176905Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 176906Family c.8.5.1: GroEL [52030] (1 protein)
  6. 176907Protein GroEL [52031] (3 species)
  7. 176908Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)
  8. 176918Domain d1jon__: 1jon - [30780]

Details for d1jon__

PDB Entry: 1jon (more details), 2.5 Å

PDB Description: groel (hsp60 class) fragment comprising residues 191-345

SCOP Domain Sequences for d1jon__:

Sequence, based on SEQRES records: (download)

>d1jon__ c.8.5.1 (-) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

Sequence, based on observed residues (ATOM records): (download)

>d1jon__ c.8.5.1 (-) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvimelekatle
dlgqakrvvinkdtttiidgv

SCOP Domain Coordinates for d1jon__:

Click to download the PDB-style file with coordinates for d1jon__.
(The format of our PDB-style files is described here.)

Timeline for d1jon__: