Class b: All beta proteins [48724] (180 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries) |
Domain d4nz8a1: 4nz8 A:64-282 [307796] Other proteins in same PDB: d4nz8a2, d4nz8a3, d4nz8a4, d4nz8a5 automated match to d4fyqa1 complexed with nag, so4, zn |
PDB Entry: 4nz8 (more details), 2 Å
SCOPe Domain Sequences for d4nz8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nz8a1 b.98.1.0 (A:64-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]} skpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskkl nyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn mppkgsstplaedpnwsvtefettpvmstyllayivsef
Timeline for d4nz8a1:
View in 3D Domains from same chain: (mouse over for more information) d4nz8a2, d4nz8a3, d4nz8a4, d4nz8a5 |