SCOP 1.61: Domain d1fy9a_: 1fy9 A:

Lineage for d1fy9a_ (1fy9 A:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families)

5. Family c.8.5.1: GroEL [52030] (1 protein)

6. Protein GroEL [52031] (3 species)

7. Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)

8. Domain d1fy9a_: 1fy9 A: [30779]

Details for d1fy9a_

PDB Entry: 1fy9, 2.2 Å

PDB Description: crystal structure of the hexa-substituted mutant of the molecular chaperonin groel apical domain

SCOP Domain Sequences for d1fy9a_:

Sequence; same for both SEQRES and ATOM records:

>d1fy9a_ c.8.5.1 (A:) GroEL {Escherichia coli}
glvprgsegmqfdrgylspyfinkpetgevelespfillvdkkisnirellpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
elgmklekatledlgqakrvvitkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

Timeline for d1fy9a_:

• d1fy9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fy9a_ appears in SCOP 1.59
  
• d1fy9a_ appears in SCOP 1.63
  
• d1fy9a_ appears in the current release, SCOPe 2.08, called d1fy9a1