Lineage for d1dkdd_ (1dkd D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176798Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 176905Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 176906Family c.8.5.1: GroEL [52030] (1 protein)
  6. 176907Protein GroEL [52031] (3 species)
  7. 176908Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)
  8. 176915Domain d1dkdd_: 1dkd D: [30778]

Details for d1dkdd_

PDB Entry: 1dkd (more details), 2.1 Å

PDB Description: crystal structure of a groel (apical domain) and a dodecameric peptide complex

SCOP Domain Sequences for d1dkdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkdd_ c.8.5.1 (D:) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

SCOP Domain Coordinates for d1dkdd_:

Click to download the PDB-style file with coordinates for d1dkdd_.
(The format of our PDB-style files is described here.)

Timeline for d1dkdd_: