Lineage for d4naqa2 (4naq A:283-544)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2571488Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2571489Protein automated matches [190805] (18 species)
    not a true protein
  7. 2571668Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries)
  8. 2571676Domain d4naqa2: 4naq A:283-544 [307771]
    Other proteins in same PDB: d4naqa1, d4naqa3, d4naqa4, d4naqa5
    automated match to d4fyta2
    complexed with nag, so4, zn

Details for d4naqa2

PDB Entry: 4naq (more details), 2.1 Å

PDB Description: crystal structure of porcine aminopeptidase-n complexed with poly- alanine
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4naqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4naqa2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp
dfnagamenwglvtyrenallfdpqsssisnkervvtviahqlahqwfgnlvtlawwndl
wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq
isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda
qtsirlpdtvraimdrwtlqmg

SCOPe Domain Coordinates for d4naqa2:

Click to download the PDB-style file with coordinates for d4naqa2.
(The format of our PDB-style files is described here.)

Timeline for d4naqa2: