SCOPe 2.08: Domain d1dkdc_: 1dkd C:

Lineage for d1dkdc_ (1dkd C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)

8. Domain d1dkdc_: 1dkd C: [30777]
   missing some secondary structures that made up less than one-third of the common domain

Details for d1dkdc_

PDB Entry: 1dkd, 2.1 Å

PDB Description: crystal structure of a groel (apical domain) and a dodecameric peptide complex

PDB Compounds: (C:) groEL

SCOPe Domain Sequences for d1dkdc_:

Sequence; same for both SEQRES and ATOM records:

>d1dkdc_ c.8.5.1 (C:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

Timeline for d1dkdc_:

• d1dkdc_ first appeared (with stable ids) in SCOP 1.55
  
• d1dkdc_ appears in SCOPe 2.07