Lineage for d1dkdb_ (1dkd B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979734Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 979893Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 979894Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 979895Protein GroEL, A domain [52031] (4 species)
  7. 979896Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 979902Domain d1dkdb_: 1dkd B: [30776]

Details for d1dkdb_

PDB Entry: 1dkd (more details), 2.1 Å

PDB Description: crystal structure of a groel (apical domain) and a dodecameric peptide complex
PDB Compounds: (B:) groEL

SCOPe Domain Sequences for d1dkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkdb_ c.8.5.1 (B:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

SCOPe Domain Coordinates for d1dkdb_:

Click to download the PDB-style file with coordinates for d1dkdb_.
(The format of our PDB-style files is described here.)

Timeline for d1dkdb_: