SCOP 1.67: Domain d1dkdb_: 1dkd B:

Lineage for d1dkdb_ (1dkd B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)

6. Protein GroEL, A domain [52031] (3 species)

7. Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)

8. Domain d1dkdb_: 1dkd B: [30776]

Details for d1dkdb_

PDB Entry: 1dkd, 2.1 Å

PDB Description: crystal structure of a groel (apical domain) and a dodecameric peptide complex

SCOP Domain Sequences for d1dkdb_:

Sequence; same for both SEQRES and ATOM records:

>d1dkdb_ c.8.5.1 (B:) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

Timeline for d1dkdb_:

• d1dkdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dkdb_ appears in SCOP 1.65
  
• d1dkdb_ appears in SCOP 1.69
  
• d1dkdb_ appears in the current release, SCOPe 2.08