Lineage for d1fyaa_ (1fya A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21364Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 21365Family c.8.5.1: GroEL [52030] (1 protein)
  6. 21366Protein GroEL [52031] (2 species)
  7. 21367Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 21371Domain d1fyaa_: 1fya A: [30774]

Details for d1fyaa_

PDB Entry: 1fya (more details), 2.2 Å

PDB Description: crystal structure of the hexa-substituted mutant of the molecular chaperonin groel apical domain

SCOP Domain Sequences for d1fyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyaa_ c.8.5.1 (A:) GroEL {Escherichia coli}
glvprgsegmqfdrgylspyfinkpetgevelespfilltdkkisnirellpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
elgmklekatledlgqakrvvitkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

SCOP Domain Coordinates for d1fyaa_:

Click to download the PDB-style file with coordinates for d1fyaa_.
(The format of our PDB-style files is described here.)

Timeline for d1fyaa_: