SCOPe 2.03: Domain d1dk7a_: 1dk7 A:

Lineage for d1dk7a_ (1dk7 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)

8. Domain d1dk7a_: 1dk7 A: [30772]

Details for d1dk7a_

PDB Entry: 1dk7, 2.02 Å

PDB Description: crystal structure of an isolated apical domain of groel

PDB Compounds: (A:) groEL

SCOPe Domain Sequences for d1dk7a_:

Sequence; same for both SEQRES and ATOM records:

>d1dk7a_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

Timeline for d1dk7a_:

• d1dk7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dk7a_ appears in SCOPe 2.02
  
• d1dk7a_ appears in SCOPe 2.04
  
• d1dk7a_ appears in the current release, SCOPe 2.08