Lineage for d1dk7a_ (1dk7 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240180Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 240287Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 240288Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 240289Protein GroEL, A domain [52031] (3 species)
  7. 240290Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)
  8. 240292Domain d1dk7a_: 1dk7 A: [30772]

Details for d1dk7a_

PDB Entry: 1dk7 (more details), 2.02 Å

PDB Description: crystal structure of an isolated apical domain of groel

SCOP Domain Sequences for d1dk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk7a_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

SCOP Domain Coordinates for d1dk7a_:

Click to download the PDB-style file with coordinates for d1dk7a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dk7b_