Lineage for d1dk7a_ (1dk7 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176798Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 176905Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 176906Family c.8.5.1: GroEL [52030] (1 protein)
  6. 176907Protein GroEL [52031] (3 species)
  7. 176908Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)
  8. 176910Domain d1dk7a_: 1dk7 A: [30772]

Details for d1dk7a_

PDB Entry: 1dk7 (more details), 2.02 Å

PDB Description: crystal structure of an isolated apical domain of groel

SCOP Domain Sequences for d1dk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk7a_ c.8.5.1 (A:) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

SCOP Domain Coordinates for d1dk7a_:

Click to download the PDB-style file with coordinates for d1dk7a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dk7b_