Lineage for d1dk7a_ (1dk7 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) 
Family c.8.5.1: GroEL [52030] (1 protein) Protein GroEL [52031] (2 species) Species Escherichia coli [TaxId:562] [52032] (10 PDB entries) 
Domain d1dk7a_: 1dk7 A: [30772]
Details for d1dk7a_
PDB Entry: 1dk7 (more details), 2.02 Å
PDB Description: crystal structure of an isolated apical domain of groel
SCOP Domain Sequences for d1dk7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dk7a_ c.8.5.1 (A:) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv
SCOP Domain Coordinates for d1dk7a_:
Click to download the PDB-style file with coordinates for d1dk7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dk7a_:
- d1dk7a_ appears in SCOP 1.57
- d1dk7a_ appears in the current release, SCOPe 2.08
View in 3D
