SCOPe 2.01: Domain d1kida_: 1kid A:

Lineage for d1kida_ (1kid A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)

8. Domain d1kida_: 1kid A: [30771]
   separately expressed fragment
   mutant

Details for d1kida_

PDB Entry: 1kid, 1.7 Å

PDB Description: groel (hsp60 class) fragment (apical domain) comprising residues 191- 376, mutant with ala 262 replaced with leu and ile 267 replaced with met

PDB Compounds: (A:) groEL (hsp60 class)

SCOPe Domain Sequences for d1kida_:

Sequence; same for both SEQRES and ATOM records:

>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

Timeline for d1kida_:

• d1kida_ first appeared (with stable ids) in SCOP 1.55, called d1kid__
  
• d1kida_ appears in SCOP 1.75
  
• d1kida_ appears in SCOPe 2.02
  
• d1kida_ appears in the current release, SCOPe 2.08