SCOP 1.71: Domain d1kid__: 1kid -

Lineage for d1kid__ (1kid -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)

8. Domain d1kid__: 1kid - [30771]
   separately expressed fragment
   mutant

Details for d1kid__

PDB Entry: 1kid, 1.7 Å

PDB Description: groel (hsp60 class) fragment (apical domain) comprising residues 191- 376, mutant with ala 262 replaced with leu and ile 267 replaced with met

SCOP Domain Sequences for d1kid__:

Sequence; same for both SEQRES and ATOM records:

>d1kid__ c.8.5.1 (-) GroEL, A domain {Escherichia coli}
glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

Timeline for d1kid__:

• d1kid__ first appeared (with stable ids) in SCOP 1.55
  
• d1kid__ appears in SCOP 1.69
  
• d1kid__ is called d1kida_ in SCOP 1.73
  
• d1kid__ appears in the current release, SCOPe 2.08, called d1kida_