Lineage for d1kid__ (1kid -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21364Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 21365Family c.8.5.1: GroEL [52030] (1 protein)
  6. 21366Protein GroEL [52031] (2 species)
  7. 21367Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 21368Domain d1kid__: 1kid - [30771]

Details for d1kid__

PDB Entry: 1kid (more details), 1.7 Å

PDB Description: groel (hsp60 class) fragment (apical domain) comprising residues 191-376, mutant with ala 262 replaced with leu and ile 267 replaced with met

SCOP Domain Sequences for d1kid__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kid__ c.8.5.1 (-) GroEL {Escherichia coli}
glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

SCOP Domain Coordinates for d1kid__:

Click to download the PDB-style file with coordinates for d1kid__.
(The format of our PDB-style files is described here.)

Timeline for d1kid__: