Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225370] (7 PDB entries) |
Domain d4krfa3: 4krf A:576-857 [307652] Other proteins in same PDB: d4krfa1, d4krfa2 automated match to d4olaa3 protein/RNA complex |
PDB Entry: 4krf (more details), 2.1 Å
SCOPe Domain Sequences for d4krfa3:
Sequence, based on SEQRES records: (download)
>d4krfa3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]} lvphqrsavfqqpviflgadvthppagdgkkpsitavvgsmdahpsrycatvrvqrprqe iiedlsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekd yqpgityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiq gtsrpshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhl vdkehdsgegshisgqsngrdpqalakavqvhqdtlrtmyfa
>d4krfa3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]} lvphqrsavfqqpviflgadvthppakkpsitavvgsmdahpsrycatvrvqrprqeiie dlsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekdyqp gityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiqgts rpshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhlvdk rdpqalakavqvhqdtlrtmyfa
Timeline for d4krfa3: