Lineage for d1cx8c2 (1cx8 C:190-382)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67590Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 67665Superfamily c.8.4: Transferrin receptor ectodomain, apical domain [52025] (1 family) (S)
  5. 67666Family c.8.4.1: Transferrin receptor ectodomain, apical domain [52026] (1 protein)
  6. 67667Protein Transferrin receptor ectodomain, apical domain [52027] (1 species)
  7. 67668Species Human (Homo sapiens) [TaxId:9606] [52028] (2 PDB entries)
  8. 67674Domain d1cx8c2: 1cx8 C:190-382 [30765]
    Other proteins in same PDB: d1cx8a1, d1cx8a3, d1cx8b1, d1cx8b3, d1cx8c1, d1cx8c3, d1cx8d1, d1cx8d3, d1cx8e1, d1cx8e3, d1cx8f1, d1cx8f3, d1cx8g1, d1cx8g3, d1cx8h1, d1cx8h3

Details for d1cx8c2

PDB Entry: 1cx8 (more details), 3.2 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor

SCOP Domain Sequences for d1cx8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx8c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens)}
iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp
vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy
tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse
sknvkltvsnvlk

SCOP Domain Coordinates for d1cx8c2:

Click to download the PDB-style file with coordinates for d1cx8c2.
(The format of our PDB-style files is described here.)

Timeline for d1cx8c2: