![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in all proteins known to contain it |
![]() | Superfamily c.8.4: Transferrin receptor ectodomain, apical domain [52025] (1 family) ![]() |
![]() | Family c.8.4.1: Transferrin receptor ectodomain, apical domain [52026] (1 protein) |
![]() | Protein Transferrin receptor ectodomain, apical domain [52027] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52028] (2 PDB entries) |
![]() | Domain d1de4f2: 1de4 F:190-382 [30761] Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b_, d1de4c1, d1de4c3, d1de4d1, d1de4d2, d1de4e_, d1de4f1, d1de4f3, d1de4g1, d1de4g2, d1de4h_, d1de4i1, d1de4i3 |
PDB Entry: 1de4 (more details), 2.8 Å
SCOP Domain Sequences for d1de4f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1de4f2 c.8.4.1 (F:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens)} iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse sknvkltvsnvlk
Timeline for d1de4f2: