Lineage for d1de4c2 (1de4 C:190-382)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240180Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 240272Superfamily c.8.4: Transferrin receptor ectodomain, apical domain [52025] (1 family) (S)
  5. 240273Family c.8.4.1: Transferrin receptor ectodomain, apical domain [52026] (1 protein)
  6. 240274Protein Transferrin receptor ectodomain, apical domain [52027] (1 species)
  7. 240275Species Human (Homo sapiens) [TaxId:9606] [52028] (2 PDB entries)
  8. 240276Domain d1de4c2: 1de4 C:190-382 [30760]
    Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b_, d1de4c1, d1de4c3, d1de4d1, d1de4d2, d1de4e_, d1de4f1, d1de4f3, d1de4g1, d1de4g2, d1de4h_, d1de4i1, d1de4i3

Details for d1de4c2

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

SCOP Domain Sequences for d1de4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens)}
iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp
vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy
tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse
sknvkltvsnvlk

SCOP Domain Coordinates for d1de4c2:

Click to download the PDB-style file with coordinates for d1de4c2.
(The format of our PDB-style files is described here.)

Timeline for d1de4c2: