SCOPe 2.06: Domain d1jdbc1: 1jdb C:2-152

Lineage for d1jdbc1 (1jdb C:2-152)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family)
   automatically mapped to Pfam PF00988

5. Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)

6. Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)

7. Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
   Uniprot P00907

8. Domain d1jdbc1: 1jdb C:2-152 [30756]
   Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl2
   complexed with adp, cl, gln, k, mn, net, orn, po4

Details for d1jdbc1

PDB Entry: 1jdb, 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

PDB Compounds: (C:) carbamoyl phosphate synthetase

SCOPe Domain Sequences for d1jdbc1:

Sequence; same for both SEQRES and ATOM records:

>d1jdbc1 c.8.3.1 (C:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

Timeline for d1jdbc1:

• d1jdbc1 first appeared (with stable ids) in SCOP 1.55
  
• d1jdbc1 appears in SCOPe 2.05
  
• d1jdbc1 appears in SCOPe 2.07
  
• d1jdbc1 appears in the current release, SCOPe 2.08