Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
Protein automated matches [190322] (4 species) not a true protein |
Species Synechococcus sp. [TaxId:32049] [194261] (4 PDB entries) |
Domain d4i0vc_: 4i0v C: [307532] automated match to d4maxa_ complexed with heb, so4 |
PDB Entry: 4i0v (more details), 1.44 Å
SCOPe Domain Sequences for d4i0vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i0vc_ a.1.1.1 (C:) automated matches {Synechococcus sp. [TaxId: 32049]} aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv lnr
Timeline for d4i0vc_: