SCOPe 2.06: Domain d4hola3: 4hol A:545-633

Lineage for d4hola3 (4hol A:545-633)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.0: automated matches [254306] (1 protein)
   not a true family

6. Protein automated matches [254707] (4 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311379] (11 PDB entries)

8. Domain d4hola3: 4hol A:545-633 [307520]
   Other proteins in same PDB: d4hola1, d4hola2, d4hola4, d4hola5
   automated match to d4fyta3
   complexed with nag, zn

Details for d4hola3

PDB Entry: 4hol, 2.1 Å

PDB Description: Crystal structure of porcine aminopeptidase-N complexed with poly-alanine

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4hola3:

Sequence; same for both SEQRES and ATOM records:

>d4hola3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

Timeline for d4hola3:

• d4hola3 is new in SCOPe 2.06-stable
  
• d4hola3 appears in SCOPe 2.07
  
• d4hola3 appears in the current release, SCOPe 2.08