SCOPe 2.06: Domain d4goca1: 4goc A:74-148

Lineage for d4goca1 (4goc A:74-148)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (7 PDB entries)

8. Domain d4goca1: 4goc A:74-148 [307452]
   Other proteins in same PDB: d4goca2, d4gocb2, d4gocc2
   automated match to d3zdmc_

Details for d4goca1

PDB Entry: 4goc, 2.4 Å

PDB Description: Crystal structure of the Get5 ubiquitin-like domain

PDB Compounds: (A:) Golgi to ER traffic protein 5

SCOPe Domain Sequences for d4goca1:

Sequence; same for both SEQRES and ATOM records:

>d4goca1 d.15.1.0 (A:74-148) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlfls
dlkvtpanstitvmi

Timeline for d4goca1:

• d4goca1 is new in SCOPe 2.06-stable
  
• d4goca1 appears in SCOPe 2.07
  
• d4goca1 appears in the current release, SCOPe 2.08