SCOPe 2.08: Domain d4g4da_: 4g4d A:

Lineage for d4g4da_ (4g4d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)

6. Protein automated matches [254746] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [256318] (10 PDB entries)

8. Domain d4g4da_: 4g4d A: [307415]
   automated match to d4f5wa_
   complexed with c2e

Details for d4g4da_

PDB Entry: 4g4d, 2.4 Å

PDB Description: sting/c-di-gmp

PDB Compounds: (A:) Transmembrane protein 173

SCOPe Domain Sequences for d4g4da_:

Sequence; same for both SEQRES and ATOM records:

>d4g4da_ d.387.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ekklnvahglawsyyigylrlilpglqarirmfnqlhnnmlsgagsrrlyilfpldcgvp
dnlsvvdpnirfrdmlpqqnidragiknrvysnsvyeilengqpagvcileyatplqtlf
amsqdakagfsredrleqaklfcrtleeiledvpesrnncrlivyqeptdgnsfslsqev
lrhirqee

Timeline for d4g4da_:

• d4g4da_ first appeared in SCOPe 2.06
  
• d4g4da_ appears in SCOPe 2.07