Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311379] (11 PDB entries) |
Domain d4fkea3: 4fke A:545-633 [307364] Other proteins in same PDB: d4fkea1, d4fkea2, d4fkea4, d4fkea5 automated match to d4fyta3 complexed with nag, zn |
PDB Entry: 4fke (more details), 1.85 Å
SCOPe Domain Sequences for d4fkea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkea3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]} fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa qndlfktasddwvllnvnvtgyfqvnyde
Timeline for d4fkea3:
View in 3D Domains from same chain: (mouse over for more information) d4fkea1, d4fkea2, d4fkea4, d4fkea5 |