SCOPe 2.06: Domain d4fjcb_: 4fjc B:

Lineage for d4fjcb_ (4fjc B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.301: Sus1-like [310571] (1 superfamily)
   5 helices; articulated hairpin fold

4. Superfamily a.301.1: Sus1-like [310603] (1 family)
   Pfam PF10163
   interactions with Sac3, Cdc31 described in PubMed 19328066

5. Family a.301.1.1: Sus1-like [310653] (3 proteins)

6. Protein Sus1 [310814] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (13 PDB entries)

8. Domain d4fjcb_: 4fjc B: [307359]
   automated match to d3fwbc_
   complexed with gol, zn

Details for d4fjcb_

PDB Entry: 4fjc, 2.83 Å

PDB Description: Structure of the SAGA Ubp8/Sgf11(1-72, Delta-ZnF)/Sus1/Sgf73 DUB module

PDB Compounds: (B:) Protein SUS1

SCOPe Domain Sequences for d4fjcb_:

Sequence; same for both SEQRES and ATOM records:

>d4fjcb_ a.301.1.1 (B:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
taqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilst
vepkalemvsdstretvlkqirefleeivdtq

Timeline for d4fjcb_:

• d4fjcb_ is new in SCOPe 2.06-stable
  
• d4fjcb_ appears in SCOPe 2.07
  
• d4fjcb_ appears in the current release, SCOPe 2.08