Lineage for d1a9xb1 (1a9x B:1502-1652)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479747Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 479799Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 479800Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 479801Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 479802Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
  8. 479803Domain d1a9xb1: 1a9x B:1502-1652 [30732]
    Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh2

Details for d1a9xb1

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

SCOP Domain Sequences for d1a9xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xb1 c.8.3.1 (B:1502-1652) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1a9xb1:

Click to download the PDB-style file with coordinates for d1a9xb1.
(The format of our PDB-style files is described here.)

Timeline for d1a9xb1: