Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Spirochaeta thermophila [TaxId:665571] [311368] (2 PDB entries) |
Domain d4d7tb_: 4d7t B: [307245] automated match to d2ptma_ complexed with cmp |
PDB Entry: 4d7t (more details), 2.58 Å
SCOPe Domain Sequences for d4d7tb_:
Sequence, based on SEQRES records: (download)
>d4d7tb_ b.82.3.0 (B:) automated matches {Spirochaeta thermophila [TaxId: 665571]} aakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrla vameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgsv evlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsrype iaaqiqelavrrkeele
>d4d7tb_ b.82.3.0 (B:) automated matches {Spirochaeta thermophila [TaxId: 665571]} aakllhrermervtaflsykkispelqrrileyfdylwetryrevlpplrlavamedvie klffidiilhlepviygpgeyiiragelgsdvyfinrgsvevlsadektryailsegqff gemalilraprtatvrartfcdlyrlketfdrlsyeiaaqiqelavrrkeele
Timeline for d4d7tb_: