Lineage for d4d6fa1 (4d6f A:421-838)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872929Species Streptococcus pneumoniae [TaxId:406556] [311248] (13 PDB entries)
  8. 2872944Domain d4d6fa1: 4d6f A:421-838 [307218]
    Other proteins in same PDB: d4d6fa2, d4d6fa3
    automated match to d2wmfa1
    complexed with edo; mutant

Details for d4d6fa1

PDB Entry: 4d6f (more details), 2.03 Å

PDB Description: crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 1 blood group a-tetrasaccharide (e558a, x01 mutant)
PDB Compounds: (A:) glycoside hydrolase

SCOPe Domain Sequences for d4d6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d6fa1 c.37.1.0 (A:421-838) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
evdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhp
ddlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstsw
idkmyqkypnlhgifstasywiwandienkaadylkvsaknggyfiwaeqnvgsaiekaf
gkngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwk
wyetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnn
kesllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtp
lymtgrynvipaipgvlktdklkesvsssriqikeitspefsstqarkeylnklypmn

SCOPe Domain Coordinates for d4d6fa1:

Click to download the PDB-style file with coordinates for d4d6fa1.
(The format of our PDB-style files is described here.)

Timeline for d4d6fa1: