Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (17 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [187329] (14 PDB entries) |
Domain d4d58b_: 4d58 B: [307204] automated match to d2j0la_ complexed with bi9, so4 |
PDB Entry: 4d58 (more details), 1.95 Å
SCOPe Domain Sequences for d4d58b_:
Sequence, based on SEQRES records: (download)
>d4d58b_ d.144.1.7 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} dyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqeal tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlsta layleskrfvhrdiaarnvlvsatdcvklgdfglsrymedstyykaskgklpikwmapes infrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlys lmtkcwaydpsrrprftelkaqlstileeeklq
>d4d58b_ d.144.1.7 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} dyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqeal tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlsta layleskrfvhrdiaarnvlvsatdcvklgdfglsrymlpikwmapesinfrrftsasdv wmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsr rprftelkaqlstileeeklq
Timeline for d4d58b_: