Lineage for d4d0ca1 (4d0c A:178-270)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365383Species Chicken (Gallus gallus) [TaxId:9031] [188287] (25 PDB entries)
  8. 2365442Domain d4d0ca1: 4d0c A:178-270 [307175]
    Other proteins in same PDB: d4d0ca2, d4d0ca3
    complexed with edo

Details for d4d0ca1

PDB Entry: 4d0c (more details), 2.81 Å

PDB Description: complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
PDB Compounds: (A:) MHC class I alpha chain 2

SCOPe Domain Sequences for d4d0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d0ca1 b.1.1.0 (A:178-270) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rrerpevrvwgkeadgiltlscrahgfyprpivvswlkdgavrgqdaqsggivpngdgty
htwvtidaqpgdgdkyqcrvehaslpqpglysw

SCOPe Domain Coordinates for d4d0ca1:

Click to download the PDB-style file with coordinates for d4d0ca1.
(The format of our PDB-style files is described here.)

Timeline for d4d0ca1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4d0cb_