Lineage for d3ezea2 (3eze A:1-21,A:145-249)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21275Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
  5. 21282Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)
  6. 21283Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
  7. 21284Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)
  8. 21288Domain d3ezea2: 3eze A:1-21,A:145-249 [30716]
    Other proteins in same PDB: d3ezea1, d3ezeb_

Details for d3ezea2

PDB Entry: 3eze (more details)

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d3ezea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezea2 c.8.1.2 (A:1-21,A:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvase

SCOP Domain Coordinates for d3ezea2:

Click to download the PDB-style file with coordinates for d3ezea2.
(The format of our PDB-style files is described here.)

Timeline for d3ezea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ezea1
View in 3D
Domains from other chains:
(mouse over for more information)
d3ezeb_