SCOPe 2.08: Domain d4ckog4: 4cko G:445-531

Lineage for d4ckog4 (4cko G:445-531)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d4ckog4: 4cko G:445-531 [307141]
   Other proteins in same PDB: d4ckoa2, d4ckob3, d4ckoc3, d4ckod3, d4ckoe3, d4ckof3, d4ckog3, d4ckoh3
   automated match to d2adca2
   complexed with cl, zn

Details for d4ckog4

PDB Entry: 4cko, 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB

PDB Compounds: (G:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckog4:

Sequence; same for both SEQRES and ATOM records:

>d4ckog4 d.58.7.0 (G:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

Timeline for d4ckog4:

• d4ckog4 first appeared in SCOPe 2.06
  
• d4ckog4 appears in SCOPe 2.07