Lineage for d4ckof4 (4cko F:445-531)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195664Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)
  8. 2195693Domain d4ckof4: 4cko F:445-531 [307139]
    Other proteins in same PDB: d4ckoa2, d4ckob3, d4ckoc3, d4ckod3, d4ckoe3, d4ckof3, d4ckog3, d4ckoh3
    automated match to d2adca2
    complexed with cl, zn

Details for d4ckof4

PDB Entry: 4cko (more details), 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB
PDB Compounds: (F:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckof4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ckof4 d.58.7.0 (F:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

SCOPe Domain Coordinates for d4ckof4:

Click to download the PDB-style file with coordinates for d4ckof4.
(The format of our PDB-style files is described here.)

Timeline for d4ckof4: