Lineage for d4ckoa2 (4cko A:337-444)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952350Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)
  8. 2952358Domain d4ckoa2: 4cko A:337-444 [307128]
    Other proteins in same PDB: d4ckoa3, d4ckob4, d4ckoc4, d4ckod4, d4ckoe4, d4ckof4, d4ckog4, d4ckoh4
    automated match to d1qm9a1
    complexed with cl, zn

Details for d4ckoa2

PDB Entry: 4cko (more details), 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB
PDB Compounds: (A:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckoa2:

Sequence, based on SEQRES records: (download)

>d4ckoa2 d.58.7.1 (A:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgs

Sequence, based on observed residues (ATOM records): (download)

>d4ckoa2 d.58.7.1 (A:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgs

SCOPe Domain Coordinates for d4ckoa2:

Click to download the PDB-style file with coordinates for d4ckoa2.
(The format of our PDB-style files is described here.)

Timeline for d4ckoa2: