Lineage for d4ck0a_ (4ck0 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256692Fold f.62: Diacylglycerol kinase (DgkA)-like [310569] (1 superfamily)
    forms homotrimer; each monomer has 3 transmembrane helices and one amphiphilic helix
  4. 2256693Superfamily f.62.1: Diacylglycerol kinase (DgkA)-like [310600] (1 family) (S)
    Pfam PF01219
  5. 2256694Family f.62.1.1: Diacylglycerol kinase (DgkA)-like [310650] (2 proteins)
  6. 2256754Protein automated matches [310880] (1 species)
    not a true protein
  7. 2256755Species Escherichia coli [TaxId:83333] [311353] (4 PDB entries)
  8. 2256762Domain d4ck0a_: 4ck0 A: [307125]
    automated match to d2kdca_
    complexed with acp, olc, zn

Details for d4ck0a_

PDB Entry: 4ck0 (more details), 2.92 Å

PDB Description: crystal structure of the integral membrane diacylglycerol kinase - form 2
PDB Compounds: (A:) Diacylglycerol kinase

SCOPe Domain Sequences for d4ck0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ck0a_ f.62.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
ftriikaagyswkglraawineaafrqegvavllavviacwldvdactrvllissvmlvm
ivellnsaieavvdrigseyhelsgrakdlgsaavliaiidavitwcillwshf

SCOPe Domain Coordinates for d4ck0a_:

Click to download the PDB-style file with coordinates for d4ck0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ck0a_: