SCOPe 2.08: Domain d4cjxa2: 4cjx A:125-297

Lineage for d4cjxa2 (4cjx A:125-297)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [311367] (1 PDB entry)

8. Domain d4cjxa2: 4cjx A:125-297 [307116]
   Other proteins in same PDB: d4cjxa1, d4cjxb1
   automated match to d4a26b2
   complexed with 9l9, gol, nap, peg

Details for d4cjxa2

PDB Entry: 4cjx, 2.05 Å

PDB Description: the crystal structure of trypanosoma brucei n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor

PDB Compounds: (A:) c-1-tetrahydrofolate synthase, cytoplasmic, putative

SCOPe Domain Sequences for d4cjxa2:

Sequence; same for both SEQRES and ATOM records:

>d4cjxa2 c.2.1.0 (A:125-297) automated matches {Trypanosoma brucei [TaxId: 999953]}
llpvnvgqlhirernpaivpctasavmellrcsgveicgkrvvvlgrgdiaglpvatlla
nedatvtvvhsatplcdiadivrasdivvsaagqpglvrgewiklgaavidvgttpvadp
skvpgyrlvgdvcfdvarkraayitpvpggvgpvtvsmllkntltmfkrsvra

Timeline for d4cjxa2:

• d4cjxa2 first appeared in SCOPe 2.06
  
• d4cjxa2 appears in SCOPe 2.07