SCOPe 2.06: Domain d4brbe_: 4brb E:

Lineage for d4brbe_ (4brb E:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.62: Diacylglycerol kinase (DgkA)-like [310569] (1 superfamily)
   forms homotrimer; each monomer has 3 transmembrane helices and one amphiphilic helix

4. Superfamily f.62.1: Diacylglycerol kinase (DgkA)-like [310600] (1 family)
   Pfam PF01219

5. Family f.62.1.1: Diacylglycerol kinase (DgkA)-like [310650] (2 proteins)

6. Protein Diacylglycerol kinase (DgkA) [310803] (1 species)

7. Species Escherichia coli K-12 [TaxId:83333] [311068] (11 PDB entries)

8. Domain d4brbe_: 4brb E: [307078]
   automated match to d3ze3a_
   complexed with 78n, act, flc, zn

Details for d4brbe_

PDB Entry: 4brb, 2.55 Å

PDB Description: crystal structure of the integral membrane enzyme dgka-ref, delta 7

PDB Compounds: (E:) Diacylglycerol kinase

SCOPe Domain Sequences for d4brbe_:

Sequence; same for both SEQRES and ATOM records:

>d4brbe_ f.62.1.1 (E:) Diacylglycerol kinase (DgkA) {Escherichia coli K-12 [TaxId: 83333]}
gvavllcvviaawldvdavtrvllissvmlvmivellnsaieavvdrigseyhelsgrak
dlgsaavliaiidavitwaillwshf

Timeline for d4brbe_:

• d4brbe_ is new in SCOPe 2.06-stable
  
• d4brbe_ appears in SCOPe 2.07
  
• d4brbe_ appears in the current release, SCOPe 2.08