SCOPe 2.06: Domain d4bq1b1: 4bq1 B:136-383

Lineage for d4bq1b1 (4bq1 B:136-383)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Zobellia galactanivorans [TaxId:63186] [224860] (6 PDB entries)

8. Domain d4bq1b1: 4bq1 B:136-383 [307070]
   Other proteins in same PDB: d4bq1a2, d4bq1b2
   automated match to d2hyka_
   complexed with ca, gol

Details for d4bq1b1

PDB Entry: 4bq1, 1.5 Å

PDB Description: crystal structure of of lamacat from zobellia galactanivorans

PDB Compounds: (B:) endo-1,3-beta-glucanase, family gh16

SCOPe Domain Sequences for d4bq1b1:

Sequence; same for both SEQRES and ATOM records:

>d4bq1b1 b.29.1.0 (B:136-383) automated matches {Zobellia galactanivorans [TaxId: 63186]}
afntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvsdgtlkira
ikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgansnetgnyf
geqygnaewpacgeidileqngwdkestiahfhwsdlnsdeyqnlggttpitnasgsfhv
yslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipenftddife
idyvriyq

Timeline for d4bq1b1:

• d4bq1b1 is new in SCOPe 2.06-stable
  
• d4bq1b1 appears in SCOPe 2.07
  
• d4bq1b1 appears in the current release, SCOPe 2.08