Lineage for d4bowb_ (4bow B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052431Species Zobellia galactanivorans [TaxId:63186] [224860] (6 PDB entries)
  8. 2052437Domain d4bowb_: 4bow B: [307063]
    automated match to d2hyka_
    complexed with ca, na

Details for d4bowb_

PDB Entry: 4bow (more details), 1.35 Å

PDB Description: crystal structure of lama_e269s from z. galactanivorans in complex with laminaritriose and laminaritetraose
PDB Compounds: (B:) endo-1,3-beta-glucanase, family gh16

SCOPe Domain Sequences for d4bowb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bowb_ b.29.1.0 (B:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
afntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvsdgtlkira
ikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgansnetgnyf
geqygnaewpacgsidileqngwdkestiahfhwsdlnsdeyqnlggttpitnasgsfhv
yslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipenftddife
idyvriyq

SCOPe Domain Coordinates for d4bowb_:

Click to download the PDB-style file with coordinates for d4bowb_.
(The format of our PDB-style files is described here.)

Timeline for d4bowb_: